PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G322200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 293aa    MW: 31448.2 Da    PI: 6.3986
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G322200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.61.5e-50121401128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptd+e++v+yLkkkv++     +++i++vdiyk++Pw+Lp k+  +e ew+fFs+r++ky++g r+nr++ sgyWkatg+dk+
  Brast01G322200.1.p  12 LPPGFRFQPTDQEIIVCYLKKKVNSAASASTSIIADVDIYKFDPWELPGKAMFGEGEWFFFSPRERKYPNGARPNRTAGSGYWKATGTDKP 102
                         79*************************988899***************77777899*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +l++ + +  g+kk Lvfy+gr+p+g ktdWvmhe+rl
  Brast01G322200.1.p 103 ILASgGARCLGVKKALVFYQGRSPRGAKTDWVMHEFRL 140
                         ***9555669**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-606172IPR003441NAC domain
PROSITE profilePS5100559.56712172IPR003441NAC domain
PfamPF023651.7E-2513140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEEGFVFRGW QLPPGFRFQP TDQEIIVCYL KKKVNSAASA STSIIADVDI YKFDPWELPG  60
KAMFGEGEWF FFSPRERKYP NGARPNRTAG SGYWKATGTD KPILASGGAR CLGVKKALVF  120
YQGRSPRGAK TDWVMHEFRL LHPDDATNNN NNNHPRDSMR LDDWVLCRVR KKGAAAAAVA  180
PDTGGLESVS GAPPPSHAGA IPAQVPDAPY GASGFGDDWT DCQILQYLIA GGGGSGQADG  240
AGAMGESAHG GTLASVLETI KRNLSFEAVD DARHHDQQLP TSSASLSMFE ID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-661217617169NO APICAL MERISTEM PROTEIN
1ut4_B4e-661217617169NO APICAL MERISTEM PROTEIN
1ut7_A4e-661217617169NO APICAL MERISTEM PROTEIN
1ut7_B4e-661217617169NO APICAL MERISTEM PROTEIN
3swm_A4e-661217620172NAC domain-containing protein 19
3swm_B4e-661217620172NAC domain-containing protein 19
3swm_C4e-661217620172NAC domain-containing protein 19
3swm_D4e-661217620172NAC domain-containing protein 19
3swp_A4e-661217620172NAC domain-containing protein 19
3swp_B4e-661217620172NAC domain-containing protein 19
3swp_C4e-661217620172NAC domain-containing protein 19
3swp_D4e-661217620172NAC domain-containing protein 19
4dul_A4e-661217617169NAC domain-containing protein 19
4dul_B4e-661217617169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-79HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565559.10.0PREDICTED: NAC transcription factor 56-like
SwissprotD2SMN46e-72NAMB1_HORVS; NAC transcription factor NAM-B1
TrEMBLA0A0Q3FVS40.0A0A0Q3FVS4_BRADI; Uncharacterized protein
STRINGSb03g000330.11e-109(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137971929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.19e-66NAC domain containing protein 2